Scaffold JGI11785J13272_1008836

Overview

Basic Information

• Taxon OID: 3300001117
• Scaffold ID: JGI11785J13272_1008836
• Source Dataset Name: Marine microbial communities from the Deep Pacific Ocean - MP2098
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1330
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates
  • Lat. (^o): 14.53
  • Long. (^o): -118.77
  • Depth (m): 294

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070936	Metagenome / Metatranscriptome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11785J13272_10088361	F070936	N/A	EFEGEELSEAWNEKLSIKALGEYRKVYNMMKKTGVDKKFIKSMEKFYDDLVIGGMYTSRGAEEKGIVKIDGKTKYKNANW*