Basic Information | |
---|---|
Taxon OID | 3300001109 Open in IMG/M |
Scaffold ID | SMH020_1010733 Open in IMG/M |
Source Dataset Name | 04YSMH020 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 871 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring → Thermal Spring Microbial Communities From Shoshone Spring, Yellowstone National Park |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Seven Mile Hole Yellowstone National Park | |||||||
Coordinates | Lat. (o) | 44.75491405 | Long. (o) | -110.41586031 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011451 | Metagenome / Metatranscriptome | 291 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SMH020_10107331 | F011451 | N/A | TMPIEIISVTFANNSTAKEWAVVSDLGGKAEVNQFCSSYGGPFCIYPWYTLGSSGFHYGVDYGDTIKDFGKANQFAQEPLCGGPFGPNTTYCDTIIIK* |
⦗Top⦘ |