Basic Information | |
---|---|
Taxon OID | 3300001109 Open in IMG/M |
Scaffold ID | SMH020_1003569 Open in IMG/M |
Source Dataset Name | 04YSMH020 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2249 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring → Thermal Spring Microbial Communities From Shoshone Spring, Yellowstone National Park |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Seven Mile Hole Yellowstone National Park | |||||||
Coordinates | Lat. (o) | 44.75491405 | Long. (o) | -110.41586031 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F100775 | Metagenome | 102 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SMH020_10035692 | F100775 | GGAGG | MGRNFTVQELADFLFDRLIVDGPSCPDTEWLRQACQDAAADLLEEAEVVYKQEPVLDGGA |
⦗Top⦘ |