Scaffold JGI12703J13194_101160

Overview

Basic Information

• Taxon OID: 3300001100
• Scaffold ID: JGI12703J13194_101160
• Source Dataset Name: Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1246
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location

• Location Name: Thunder Bay, Ontario, Canada
• Coordinates
  • Lat. (^o): 49.08
  • Long. (^o): -89.38

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043547	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12703J13194_1011603	F043547	AGAAGG	VRAETRHQLKQDRFSKVTFEAAGNAVHWTAEHQAKLIAAVIAVVVIAAIAFGGWYYVNAQDEKASAELSTAVRTFETPVRPAGVPPQPGTDSF