Scaffold JGI12104J13512_1030321

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12104J13512_1030321

Scaffold JGI12104J13512_1030321

Overview

Basic Information
Taxon OID	3300001095 Open in IMG/M
Scaffold ID	JGI12104J13512_1030321 Open in IMG/M
Source Dataset Name	Wastewater bioreactor microbial communities from Singapore -Terephthalate degrading community TA Biofilm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	993
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Terephthalate → Wastewater → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Singapore And Univ Of Illinois At Urbana, That Are Terephthalate-Degrading

Source Dataset Sampling Location
Location Name	National University of Singapore, Singapore
Coordinates	Lat. (^o)	1.29973	Long. (^o)	103.771791	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053724	Metagenome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12104J13512_10303212	F053724	GAGG	MREIRVLVRLQVEECEGDGKFDREMMEDAAVEAVENAMRHAEGVGFPHTYEEELSVCFVDAVLYEESDDDLHEE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.