Scaffold JGI10216J12902_110269434

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI10216J12902_110269434

Scaffold JGI10216J12902_110269434

Overview

Basic Information
Taxon OID	3300000956 Open in IMG/M
Scaffold ID	JGI10216J12902_110269434 Open in IMG/M
Source Dataset Name	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	603
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location Name	Kansas, USA
Coordinates	Lat. (^o)	39.214012	Long. (^o)	-96.585283	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054387	Metagenome	140	N

Sequences

Protein ID	Family	RBS	Sequence
JGI10216J12902_1102694341	F054387	GGAG	MDDPISPARRTLLKAGAATLATPVAAAIAQPAGHQEAKSFDLWVISDQHVGTDKAASEGIQHGLVG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.