Scaffold JGI10216J12902_108206113

Overview

Basic Information

• Taxon OID: 3300000956
• Scaffold ID: JGI10216J12902_108206113
• Source Dataset Name: Soil microbial communities from Great Prairies - Kansas, Native Prairie soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1420
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: Kansas, USA
• Coordinates
  • Lat. (^o): 39.214012
  • Long. (^o): -96.585283

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035466	Metagenome / Metatranscriptome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI10216J12902_1082061133	F035466	N/A	MKTKSLKAIAAVAVGLLAIGTTLHAQGVDTRTSHPVMDATAITKADAEKKYPPPSSGTYPLGSRDAHDPSGVVASPYPPYQKYNCSKINHGGLVVDIRAKKVFVYP*