Scaffold JGI11615J12901_11497330

Overview

Basic Information

• Taxon OID: 3300000953
• Scaffold ID: JGI11615J12901_11497330
• Source Dataset Name: Soil microbial communities from Great Prairies - Kansas Corn soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 693
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → unclassified Nitrobacter → Nitrobacter sp. Nb-311A (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: Kansas, USA
• Coordinates
  • Lat. (^o): 39.211666
  • Long. (^o): -96.594768

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068533	Metagenome	124	N

Sequences

Protein ID	Family	RBS	Sequence
JGI11615J12901_114973302	F068533	GGAG	VRNIARWSAPAAIAIFLTSAQFASSDQGLTGDVRTTFVDALIRSCLKTQLDAPTNKGIPISAIQDYCKCNASDLADKISNDEVKSLEAAGSEEKYRSA