Scaffold BBAY94_10144659

Overview

Basic Information

• Taxon OID: 3300000949
• Scaffold ID: BBAY94_10144659
• Source Dataset Name: Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 646
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Source Dataset Sampling Location

• Location Name: Botany Bay, Sydney, NSW, Australia
• Coordinates
  • Lat. (^o): -33.966629
  • Long. (^o): 151.166614

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062681	Metagenome	130	N

Sequences

Protein ID	Family	RBS	Sequence
BBAY94_101446591	F062681	N/A	RCAMTEFKDAVEKQRGLQAYEEWAQQIRYIHSDGWDNTRTVVYNDGTRKLYNIKTNQLIYEKPRNKHRRDLINSNAFSRFLEKIGFYGENNETGT*