Basic Information | |
---|---|
Taxon OID | 3300000931 Open in IMG/M |
Scaffold ID | JGI12531J12852_10067815 Open in IMG/M |
Source Dataset Name | Aerobic enrichment media microbial communities from Bioluminiscent Bay, La Parguera, Puerto Rico - Tt and P1 (2) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 857 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Defined Media → Aerobic Media → Unclassified → Aerobic Enrichment Media → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bioluminescent Bay, La Paraguera, Puerto Rico | |||||||
Coordinates | Lat. (o) | 17.967317 | Long. (o) | -67.018833 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F017885 | Metagenome / Metatranscriptome | 238 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI12531J12852_100678153 | F017885 | GAGG | MANPNADVAGFQCPKCGQELEQTIGQLKSSEHMICSGCGIGINIDTNRLANLADELQKATAKVPPEITVKFYR* |
⦗Top⦘ |