NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BpDRAFT_10215800

Scaffold BpDRAFT_10215800


Overview

Basic Information
Taxon OID3300000930 Open in IMG/M
Scaffold IDBpDRAFT_10215800 Open in IMG/M
Source Dataset NameMarine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)836
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location NameColumbia River plume, coastal ocean
CoordinatesLat. (o)46.233Long. (o)-124.16Alt. (m)Depth (m)16
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007003Metagenome / Metatranscriptome360Y

Sequences

Protein IDFamilyRBSSequence
BpDRAFT_102158001F007003N/AIDQKKYNDIIQRIIMINGNDGTNNSGYKAWQNFEENWTLNIIPVTDQEDFKVYYKHLNVETSDGIAWGVTGVKVIYMFVNDVKNPFIIRQNVMPLGHELLHAIYQDAVGTSHITRRHDAPEGRANTRGAAATVIVHDNWYGTKKTIKIWIRWSMIWLPITIPFIPVKEAKKWYAI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.