Basic Information | |
---|---|
Taxon OID | 3300000930 Open in IMG/M |
Scaffold ID | BpDRAFT_10046876 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Maryland |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1100 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → Viruses → environmental samples → uncultured marine virus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Columbia River plume, coastal ocean | |||||||
Coordinates | Lat. (o) | 46.233 | Long. (o) | -124.16 | Alt. (m) | Depth (m) | 16 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F083376 | Metagenome / Metatranscriptome | 113 | N |
F100885 | Metagenome / Metatranscriptome | 102 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BpDRAFT_100468761 | F100885 | N/A | MAERIAGIALMPRQSRNGVYYDTEELKKFDGKTVPLRVEHNKETHIGQVTFSFDEEKSQVKYEATVFDSEWQKTLENEQYQVSIGASVLEQRTLCDEMKAKCLNAPVLDEILELSVVRTPGIPESTLHVVESHNAQ |
BpDRAFT_100468763 | F083376 | N/A | NVIESLDLGRVSLGETVKYTMYMKNTDTQWPVHNIKIENANPELRFEIPDVLKANEVKEVFVYWTPKLDSREPLLTKFEFSGDVFIG* |
⦗Top⦘ |