NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold OpTDRAFT_10009094

Scaffold OpTDRAFT_10009094


Overview

Basic Information
Taxon OID3300000928 Open in IMG/M
Scaffold IDOpTDRAFT_10009094 Open in IMG/M
Source Dataset NameMarine plume microbial communities from the Columbia River - 25 PSU
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6801
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location NameColumbia River plume, coastal ocean
CoordinatesLat. (o)46.233Long. (o)-124.16Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004956Metagenome / Metatranscriptome417Y
F015474Metagenome / Metatranscriptome254Y
F066238Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
OpTDRAFT_1000909411F015474GGAMSGQFPTNPNFKSLNFKDNRPTLVNQTLSGKKQVRQIGAQYFSFTVSMPPLQQEKAQEVFAFLQKQKGSSGDFTIVA
OpTDRAFT_100090944F066238AGAAGMPMEFDRDFNGYLDATYGHGIQITYTPTGGSSSSINVILNQEYVDIDSGGLPVQGYQPVAQVKTTDIPSIAFGDTIAAPAIKNLDGTQIKAATNYKVINFEHDNLGMTSLLLEVQ*
OpTDRAFT_100090946F004956AGGAGMKMISPNGKVSIEVPQSNVETMLDMGWKEEAVQSQDKIKSSSKKKPKGEVKENVNI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.