Scaffold WSSedA2C3DRAFT_1047385

Overview

Basic Information

• Taxon OID: 3300000917
• Scaffold ID: WSSedA2C3DRAFT_1047385
• Source Dataset Name: Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A2 Cattail
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 604
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta

Source Dataset Sampling Location

• Location Name: Twitchell Island in the Sacramento/San Joaquin Delta, CA
• Coordinates
  • Lat. (^o): 38.107057
  • Long. (^o): -121.647578
  • Depth (m): 0 to .12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014730	Metagenome / Metatranscriptome	260	Y

Sequences

Protein ID	Family	RBS	Sequence
WSSedA2C3DRAFT_10473851	F014730	N/A	MVFKREIGTTCSLDIEMLDTINDGIVLSIDKNLVNSNNLSFITDFVGQHNLSLLLDSERYFISSKXLAPYAKSSWESW*