Scaffold WSSedL1B2DRAFT_1013368

Overview

Basic Information

• Taxon OID: 3300000894
• Scaffold ID: WSSedL1B2DRAFT_1013368
• Source Dataset Name: Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L1 Bulk
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 708
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta

Source Dataset Sampling Location

• Location Name: Twitchell Island in the Sacramento/San Joaquin Delta, CA
• Coordinates
  • Lat. (^o): 38.106796
  • Long. (^o): -121.646457
  • Depth (m): 0 to .12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036769	Metagenome / Metatranscriptome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
WSSedL1B2DRAFT_10133681	F036769	N/A	PDPADVQAAAPQDVMAGYWVLTFEDGRVGWANLVSDDYAKTSFSSKGKVEVPGFKPVDITSGVIPEFYKVGQVILYNAQATQKPFHFVRFVIEGNQFMTGYVATFDNKQYKFKAHRR*