Scaffold JGI10214J12806_11041841

Overview

Basic Information

• Taxon OID: 3300000891
• Scaffold ID: JGI10214J12806_11041841
• Source Dataset Name: Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 1178
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: Iowa, USA
• Coordinates
  • Lat. (^o): 43.303333
  • Long. (^o): -89.334167

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022659	Metagenome / Metatranscriptome	213	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI10214J12806_110418412	F022659	N/A	VYLAGLRIPDEDVRELIGLVDEPTRSFLERSLALDSEVVALTVEDRERVLWALDDVRTDGLVELRGVLLQEHEWRERPV*