NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FwDRAFT_10041479

Scaffold FwDRAFT_10041479


Overview

Basic Information
Taxon OID3300000882 Open in IMG/M
Scaffold IDFwDRAFT_10041479 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Columbia River
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3028
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location NameColumbia River freshwater tidal region
CoordinatesLat. (o)46.18Long. (o)-123.18Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070112Metagenome123N

Sequences

Protein IDFamilyRBSSequence
FwDRAFT_100414793F070112GAGMKLLGILKNILFEEKISNPIVDVSLNDYKIRFILSTHAQERMTRKENDSDITVDEIKSAIEDAVPKITNKAFVVQKRAIQGPVIDGTLLKKDFSSGQTRKENAQEFFIVKTDSGLQINCKVLNFNKNKGEIEIIIKTLMKSHTNQLNINNARRNTLHLNIVENLDDFDNYFTITV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.