Basic Information | |
---|---|
Taxon OID | 3300000882 Open in IMG/M |
Scaffold ID | FwDRAFT_10033376 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from the Columbia River |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Maryland |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1081 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Columbia River freshwater tidal region | |||||||
Coordinates | Lat. (o) | 46.18 | Long. (o) | -123.18 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001732 | Metagenome / Metatranscriptome | 644 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
FwDRAFT_100333761 | F001732 | N/A | MTFKLPIFIILVFLFTGCFSTIKPSKQIDDNQKIIAKEEKKVDNTLVEIEKNDKGKKIQTSGLSIGIQHSLNQVTNAPVQVDTALKLNERVISIVGSPHIDETKRIKATVDLLNSALVEERKKGEELLTQRDELINKLQKEKSELNQKYDDQLWQLTDKAKEVAKEADQNKAVLDSMSGMFGLNAVFWGLKKFIVSALTAILVFVVVFVLLRLLATVHPAAAAAFSIFNMLGSAIISILKALTPKAFEMCDFATKDKVDEFKSPLVKIVDVIQELKVKQKESPDRVYPLNELLKRFEKEMDSDEKDLIDNILREQKWIK* |
⦗Top⦘ |