NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold FwDRAFT_10030499

Scaffold FwDRAFT_10030499


Overview

Basic Information
Taxon OID3300000882 Open in IMG/M
Scaffold IDFwDRAFT_10030499 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Columbia River
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1617
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location NameColumbia River freshwater tidal region
CoordinatesLat. (o)46.18Long. (o)-123.18Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062754Metagenome / Metatranscriptome130N
F075707Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
FwDRAFT_100304992F075707AGGMTKLLLGLTILVLVYIVGWHQIYGQFIHSFYKKYEMYLIWLSVPSTLLSIYATKLLAEYFNGKMWPNRIFTFSIGIVMFTILTHIYFNEKLSYKTLTLIALSGLIVILQIIWK*
FwDRAFT_100304997F062754N/ASSMKKLTKKEQEEIKMKLAYFDKIVKDTRELIKQGYTMPNLSCLVVPRQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.