Scaffold FwDRAFT_10011667

Overview

Basic Information

• Taxon OID: 3300000882
• Scaffold ID: FwDRAFT_10011667
• Source Dataset Name: Freshwater microbial communities from the Columbia River
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1499
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location

• Location Name: Columbia River freshwater tidal region
• Coordinates
  • Lat. (^o): 46.18
  • Long. (^o): -123.18
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005879	Metagenome / Metatranscriptome	387	Y

Sequences

Protein ID	Family	RBS	Sequence
FwDRAFT_100116671	F005879	N/A	DKTMFENTIFWKDTFDGEKAQGGIFYRAVDLKKFMELVEANENGNGGEIVGIRFDENNVEFIVKK*