Scaffold JGI10215J12807_1053715

Overview

Basic Information

• Taxon OID: 3300000881
• Scaffold ID: JGI10215J12807_1053715
• Source Dataset Name: Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1441
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.303611
  • Long. (^o): -89.332778

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066821	Metagenome / Metatranscriptome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI10215J12807_10537152	F066821	N/A	VLPEIVLGRSKGDLHKWPPFWPLRFADQAHVRFSRKTVAFTRVARNTRANHVFPSRRPAPVARHDVIQIKLAAIEELATVLAGVLVSLKHVVSGEFYFLLRKPIEHKQHNHPWDPDLERNGRNHFMLGRVGGQIAPAFEIVRRKVICIIRRNNLGVPCIYERKGAASRADVHRLPEPVKHQNLTVQQRMQVWNGNLVIARLLRTSA*