Scaffold AP72_2010_repI_A100DRAFT_1050451

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold AP72_2010_repI_A100DRAFT_1050451

Scaffold AP72_2010_repI_A100DRAFT_1050451

Overview

Basic Information
Taxon OID	3300000837 Open in IMG/M
Scaffold ID	AP72_2010_repI_A100DRAFT_1050451 Open in IMG/M
Source Dataset Name	Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	587
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil

Source Dataset Sampling Location
Location Name	Amazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil
Coordinates	Lat. (^o)	-10.171667	Long. (^o)	-62.7875	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039290	Metagenome / Metatranscriptome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
AP72_2010_repI_A100DRAFT_10504511	F039290	N/A	LDRILPIHGDMAQHSLGKVTLQDLKPHGLLDLYRQGTTWVAFIRLKNGRMTNLPLEPTLVTRKAALQFLKIELEKPFSGLEA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.