Scaffold JGI12397J12024_1089040

Overview

Basic Information

• Taxon OID: 3300000829
• Scaffold ID: JGI12397J12024_1089040
• Source Dataset Name: Soil microbial communities from Moab, Utah, sample - Soil Crust Prior wet up (biological replicate A) 0A (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 644
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → Nostoc punctiforme (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location

• Location Name: Moab, Utah
• Coordinates
  • Lat. (^o): 38.714694
  • Long. (^o): -109.692944

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058553	Metagenome / Metatranscriptome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12397J12024_10890402	F058553	AGGAG	MAQTRAVLPARFVPLADELLVATGVNDYSTLIGILLSRYGKHLLSTWEIANCPQATLATSQPIASVSIAQPETFTPMEF*