NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BS_KBA_SWE02_21mDRAFT_10053762

Scaffold BS_KBA_SWE02_21mDRAFT_10053762


Overview

Basic Information
Taxon OID3300000792 Open in IMG/M
Scaffold IDBS_KBA_SWE02_21mDRAFT_10053762 Open in IMG/M
Source Dataset NameMarine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1130
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → unclassified Desulfobacca → Desulfobacca sp. RBG_16_60_12(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine → Marine Microbial Communities From Chronically Polluted Sediments In Four Geographic Locations

Source Dataset Sampling Location
Location NameKBA site, Vaertahamnen, Baltic Sea, Sweden
CoordinatesLat. (o)59.363333Long. (o)18.119167Alt. (m)Depth (m)21
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021446Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
BS_KBA_SWE02_21mDRAFT_100537623F021446AGGAGGMKTLSIALMATFMLVLAATSTGQAQSAEDGYNDPNPGGKYVYRGCNLAQVIFIRGDKLSEINELTLIIEVQGGQDSHTLRLTFPILAKRQEGNKLILDYQWPLGGDTYEATIIGGTLINRKTKGYLAGIREEMFTRE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.