Scaffold JGI12272J11983_1100487

Overview

Basic Information

• Taxon OID: 3300000750
• Scaffold ID: JGI12272J11983_1100487
• Source Dataset Name: Soil microbial communities from Moab, Utah, sample - Soil Crust Dry out, 3 days (biological replicate A) D5A (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 519
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Siccirubricoccus → unclassified Siccirubricoccus → Siccirubricoccus sp. G192 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Four Geographically Distinct Crusts In The Colorado Plateau And Sonoran Desert

Source Dataset Sampling Location

• Location Name: Moab, Utah
• Coordinates
  • Lat. (^o): 38.714694
  • Long. (^o): -109.692944

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087716	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12272J11983_11004871	F087716	N/A	EDRAMTKEEIEALVARERPGWRVAEVIEVNDESGPSFEVTMERGDERRTLLLGADERIVGERR*