Scaffold JGI12547J11936_1045105

Overview

Basic Information

• Taxon OID: 3300000736
• Scaffold ID: JGI12547J11936_1045105
• Source Dataset Name: Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 915
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location

• Location Name: Lake Erie, Canada
• Coordinates
  • Lat. (^o): 41.77
  • Long. (^o): -81.73
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015065	Metagenome / Metatranscriptome	257	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12547J11936_10451052	F015065	N/A	MSASNQFKSICTQNDMRLGKNQEMKLFTLEYNYNNSNFNIVSLINVNLHKLLHEVNKDIIDVIDIQPHPTDPSEHNILYQFRDMGGDLGGFKTYMYVNTKIAKRYSSNGNTEIIFTSKSVPYEYHAHLVQQKYKLLEYPLYIQKYIYQETSVTSLPVSTIQVLHMFKLKPDNESELTVAMENAIGILIKKMYFRLKVAIETLRSS*