Scaffold JGI12547J11936_1016123

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12547J11936_1016123

Scaffold JGI12547J11936_1016123

Overview

Basic Information
Taxon OID	3300000736 Open in IMG/M
Scaffold ID	JGI12547J11936_1016123 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1855
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location Name	Lake Erie, Canada
Coordinates	Lat. (^o)	41.77	Long. (^o)	-81.73	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010817	Metagenome / Metatranscriptome	298	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12547J11936_10161233	F010817	AGGA	LNKLASILALNFLFIGCATVTPNKIQDDKSSYDATTPKQYDKDNGGLISFLGDNALITRQARERYNNLIKMYRIKFKKEKAIDLVEDSGVKPYKDTFGNELFLIDSEHLVYFGVLNSWLKEKVPADNIIDKTIDKINN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.