NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12547J11936_1013350

Scaffold JGI12547J11936_1013350


Overview

Basic Information
Taxon OID3300000736 Open in IMG/M
Scaffold IDJGI12547J11936_1013350 Open in IMG/M
Source Dataset NameFreshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2072
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)41.77Long. (o)-81.73Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002245Metagenome / Metatranscriptome578Y
F014138Metagenome / Metatranscriptome265Y
F020168Metagenome / Metatranscriptome225Y

Sequences

Protein IDFamilyRBSSequence
JGI12547J11936_10133502F020168GAGMTDMIGSVIAIILIAFLCSPIVLATYVWRGAKVDNNHDGKDDVPYRWEQE*
JGI12547J11936_10133503F002245AGGMSNLIKVPHSVVFEAIIDLDKVPANLLPALLKLTETDLLTMCKEATETAISESKFLQIANENNSWAEVIIKGDN*
JGI12547J11936_10133507F014138AGGMANRYRVEIYDANKLNDVTIYSEQGVDKEYLTELVFSNLNKFSGKINAYVF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.