Scaffold fpDRAFT_1007662

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold fpDRAFT_1007662

Scaffold fpDRAFT_1007662

Overview

Basic Information
Taxon OID	3300000730 Open in IMG/M
Scaffold ID	fpDRAFT_1007662 Open in IMG/M
Source Dataset Name	Illumina Fosmids (spades contigs)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Illumina
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	38836
Total Scaffold Genes	67 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	57 (85.07%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Activated Sludge → Activated Sludge Microbial Communities From San Jose - Santa Clara Water Pollution Control Plant, Ca

Source Dataset Sampling Location
Location Name	San Jose/Santa Clara Water Pollution Control Plant
Coordinates	Lat. (^o)	37.434249	Long. (^o)	-121.946397	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078624	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
fpDRAFT_100766238	F078624	GGAG	MKLCIHVRPRDDGQGWAVDVFDGRRAWTKTHLGESPLNKAEAHRLAHKLRDPKFYTARTKRAVNSGGAL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.