Scaffold JGI12410J11868_105001

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12410J11868_105001

Scaffold JGI12410J11868_105001

Overview

Basic Information
Taxon OID	3300000721 Open in IMG/M
Scaffold ID	JGI12410J11868_105001 Open in IMG/M
Source Dataset Name	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	517
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location Name	Luquillo Experimental Forest Soil, Puerto Rico
Coordinates	Lat. (^o)	18.0	Long. (^o)	-65.0	Alt. (m)		Depth (m)	.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040312	Metagenome / Metatranscriptome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12410J11868_1050011	F040312	N/A	VLYAIYFQLARTAAWRGARASKLCVFNFALVILSFTVVNLYLSQHHRYF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.