Scaffold AP72_2010_repI_A1DRAFT_1000244

Overview

Basic Information

• Taxon OID: 3300000650
• Scaffold ID: AP72_2010_repI_A1DRAFT_1000244
• Source Dataset Name: Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 2804
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil

Source Dataset Sampling Location

• Location Name: Amazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil
• Coordinates
  • Lat. (^o): -10.171667
  • Long. (^o): -62.7875

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008658	Metagenome / Metatranscriptome	330	Y

Sequences

Protein ID	Family	RBS	Sequence
AP72_2010_repI_A1DRAFT_10002441	F008658	AGGAGG	MGKLTAEQKVREYNRGQKAAREGRSRSWSEPWAYPFESNQHYEERREAFNQGYGIIDATPMSVRRRSPP*