Scaffold AF_2010_repII_A01DRAFT_1054215

Overview

Basic Information

• Taxon OID: 3300000580
• Scaffold ID: AF_2010_repII_A01DRAFT_1054215
• Source Dataset Name: Forest soil microbial communities from Amazon forest - 2010 replicate II A01
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 615
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Amazon Forest, Brazil

Source Dataset Sampling Location

• Location Name: Amazon forest, Fazenda Nova Vida, City of Ariquemes, State of Rondonia, Brazil
• Coordinates
  • Lat. (^o): -10.171667
  • Long. (^o): -62.7875

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048595	Metagenome / Metatranscriptome	148	N

Sequences

Protein ID	Family	RBS	Sequence
AF_2010_repII_A01DRAFT_10542151	F048595	GGA	MKVAXFVNPLVQTSGPGFNYGGVQALVELLQPLHREARCECALITGRWFKDWARQNGKTHLLNGLRTVWLDELSLYRRLRKLGVLPTELDQTEHQADDTEQPALGIIAEMIARHVNG