Scaffold Draft_10033622

Overview

Basic Information

• Taxon OID: 3300000558
• Scaffold ID: Draft_10033622
• Source Dataset Name: Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1236
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Megasphaera → Megasphaera massiliensis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: Syncrude, Ft. McMurray, Alberta
• Coordinates
  • Lat. (^o): 57.02
  • Long. (^o): -111.55

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057400	Metagenome / Metatranscriptome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
Draft_100336222	F057400	N/A	MERFIKLASIIIITLALVMCGLYWSQXTKVRQDIMSKSDEEYILMVLRQKAADDCVLTPISENVWACKEWKSGKIFMVRR*