NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_10001368

Scaffold Draft_10001368


Overview

Basic Information
Taxon OID3300000558 Open in IMG/M
Scaffold IDDraft_10001368 Open in IMG/M
Source Dataset NameWastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15938
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (88.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameSyncrude, Ft. McMurray, Alberta
CoordinatesLat. (o)57.02Long. (o)-111.55Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033858Metagenome / Metatranscriptome176N
F058258Metagenome135N

Sequences

Protein IDFamilyRBSSequence
Draft_100013688F058258AGGAGGVRKIVILAFAALMAGCASLPPTIDQGEYQNYRYGFIVRLPEGGWQMTKTVPDGFADYLVPEVSEKVELLLHNPQTRGLIAVRGGSLYLSYESALTFQERLTEMIEPVLDVDWALLVRDVPESRGSYRLGHWDASGLQWQERSGSSPLDGIRHTSMGYYYPLNGETCYVTFYLFSEPDTFDRNVKVLQRMAGTFSSGEVFTSRGYGW*
Draft_100013689F033858AGGMLEVGFKSENLSEMIQCQIELEELAARLQAEQGDLVTAQQCEQAKASLDAFVALVDRAMEKAALAESIPSGAPXPKPTTLG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.