Scaffold SL_8KL_010_SEDDRAFT_10075445

Overview

Basic Information

• Taxon OID: 3300000557
• Scaffold ID: SL_8KL_010_SEDDRAFT_10075445
• Source Dataset Name: Alkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1297
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location

• Location Name: Russia: Kulunda Steppe, Lake Tanatar
• Coordinates
  • Lat. (^o): 51.39
  • Long. (^o): 79.48

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015419	Metagenome / Metatranscriptome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
SL_8KL_010_SEDDRAFT_100754452	F015419	N/A	MKYELKIKDEHGNEHLYNVVRSSSDEPKNLNDFILEALSISEDKRQLPFLTQCPNGLEVHPSIKMKFENYGSSLLGDKLQAMMVTWRD*