NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SL_8KL_010_SEDDRAFT_10014700

Scaffold SL_8KL_010_SEDDRAFT_10014700


Overview

Basic Information
Taxon OID3300000557 Open in IMG/M
Scaffold IDSL_8KL_010_SEDDRAFT_10014700 Open in IMG/M
Source Dataset NameAlkaline sediment microbial communities from Lake Tanatar, Kulunda Steppe, Russia - 8KL_010_SED
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5071
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Sediment → Alkaline Sediment → Alkaline Sediment Microbial Communities From Soda Lakes And Soda Solonchak Soils

Source Dataset Sampling Location
Location NameRussia: Kulunda Steppe, Lake Tanatar
CoordinatesLat. (o)51.39Long. (o)79.48Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105255Metagenome / Metatranscriptome100Y

Sequences

Protein IDFamilyRBSSequence
SL_8KL_010_SEDDRAFT_100147004F105255AGGAGGMESRVFTKLIDKHYSPLVIRKYTHYGFPIYIGLITDNDLSDLDDVAVNFMKEHSGEGWVNDIQKVRNLAGSFTEHLNNYYDRAEGVAVMLYVDKMFVSSLHGDFMNHSACRAEFYSLLNMSTGV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.