NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TBL_comb47_HYPODRAFT_10023046

Scaffold TBL_comb47_HYPODRAFT_10023046


Overview

Basic Information
Taxon OID3300000553 Open in IMG/M
Scaffold IDTBL_comb47_HYPODRAFT_10023046 Open in IMG/M
Source Dataset NameTrout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)4833
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003007Metagenome / Metatranscriptome513Y
F029022Metagenome189Y

Sequences

Protein IDFamilyRBSSequence
TBL_comb47_HYPODRAFT_100230463F029022GAGGMSLAEVESKIDTHIDICAVRYEGIEKEMRGVNARLKRLEGILIGGAGAIIGLLIHLITKG
TBL_comb47_HYPODRAFT_100230464F003007GAGMYKEGRQFVVDAKKEIDGVVGDIKGIQKDAQGIFGFFKKLFGVQQETQKQQTQVGPAPVKKTKKKAVEFDENQIYAQVADALTKFFHAYNGLKAYAKEQEEIALTASGEEGQDIAIKLVIANLQMEKLNEEMREYMVYHVPEEMKDLYSRVNKMVGHIANQQALARKAELDKKKKIAWQKRQRQEEIQDKAIAITLTALMIGWVWVMMMIVRFSSMLS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.