Scaffold F24TB_13407545

Overview

Basic Information

• Taxon OID: 3300000550
• Scaffold ID: F24TB_13407545
• Source Dataset Name: Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 518
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mesoamericanum (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Kansas Great Prairie, Usa, Amended With Brdu

Source Dataset Sampling Location

• Location Name: Kanza Prairie, Kansas, USA
• Coordinates
  • Lat. (^o): 39.100992
  • Long. (^o): -96.608258

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011352	Metagenome / Metatranscriptome	292	Y

Sequences

Protein ID	Family	RBS	Sequence
F24TB_134075451	F011352	AGGA	MSRYYFHLSDGKQLLNNHKGVDLSGNAAAREDALVLARDLKHGAVMPGWDWEGWFVMIVDAHGHKVDEVPIADV*