NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CNXas_1001913

Scaffold CNXas_1001913


Overview

Basic Information
Taxon OID3300000545 Open in IMG/M
Scaffold IDCNXas_1001913 Open in IMG/M
Source Dataset NameQuercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI), Lifesequencing S.L.
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1420
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere → Quercus Rhizosphere Microbial Communities From Sierra Nevada National Park, Granada, Spain

Source Dataset Sampling Location
Location NameSierra Nevada National Park, Granada, Spain
CoordinatesLat. (o)36.965667Long. (o)-3.429194Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000708Metagenome / Metatranscriptome926Y

Sequences

Protein IDFamilyRBSSequence
CNXas_10019132F000708GAGMTKPDPALAEIAAQFTRHDVEWSRGAYVIIDRRTANPIARLRPIPDTDRFELFYWSNAKGRWTTFGNLGRMKLMLESAHEIVENDPMFRIPRAS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.