Scaffold JGI1221J11331_1049906

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI1221J11331_1049906

Scaffold JGI1221J11331_1049906

Overview

Basic Information
Taxon OID	3300000525 Open in IMG/M
Scaffold ID	JGI1221J11331_1049906 Open in IMG/M
Source Dataset Name	Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	804
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica

Source Dataset Sampling Location
Location Name	Lake Vida, Antarctica
Coordinates	Lat. (^o)	-77.38861	Long. (^o)	161.931111	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049993	Metagenome	146	N

Sequences

Protein ID	Family	RBS	Sequence
JGI1221J11331_10499063	F049993	AGGA	MNRNQVLKEIDEQTIEELSSKYKMSISTFWMRLKEFQEEVQAQEEWAVIRVHPKWINGISHLLDNKGIPHEIPGDFELIEKYESKF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.