NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ZC3D99_100177

Scaffold ZC3D99_100177


Overview

Basic Information
Taxon OID3300000514 Open in IMG/M
Scaffold IDZC3D99_100177 Open in IMG/M
Source Dataset NameCompost microbial communities from Sao Paulo Zoo, Brazil - ZC3D99
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Sao Paulo
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7957
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (58.82%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Source Dataset Sampling Location
Location NameSao Paulo Zoo Park
CoordinatesLat. (o)-23.651079Long. (o)-46.620668Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088555Metagenome109N

Sequences

Protein IDFamilyRBSSequence
ZC3D99_10017716F088555GGAGGMALRMYFDETVSSLVRDDISPTLGSPDTYEGPGAGGTVERKLYIYSDNFQRTYSQVQLTSLNADAQVQLHYALDDNGSPGTWQTTVDLPDGDYRTPYPIWVRVTFAPTDEPTLRTDLRHWLQWLEASRGDLIGYSRAHQHGC*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.