Scaffold Foulum_1009124

Overview

Basic Information

• Taxon OID: 3300000510
• Scaffold ID: Foulum_1009124
• Source Dataset Name: Anaerobic digester microbial communities from Northern Denmark, sample from Foulum manure
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Aalborg University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2312
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → Gemmata palustris (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark

Source Dataset Sampling Location

• Location Name: Soeholt, Denmark
• Coordinates
  • Lat. (^o): 56.496244
  • Long. (^o): 9.599689

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078675	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Foulum_10091242	F078675	AGG	MTTKKQAKEKIMPDKHTPGPWTIYRHAGTNSGHYDGYLKSDIRAGSDLIHIRQSVAGNTFPRLAANVRLMAAAPSMYDALWAIANMQVQDETDKGEVLALCMSIARIEIEKCSTAGKSTA