Scaffold Foulum_1000501

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Foulum_1000501

Scaffold Foulum_1000501

Overview

Basic Information
Taxon OID	3300000510 Open in IMG/M
Scaffold ID	Foulum_1000501 Open in IMG/M
Source Dataset Name	Anaerobic digester microbial communities from Northern Denmark, sample from Foulum manure
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Aalborg University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1395
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark

Source Dataset Sampling Location
Location Name	Soeholt, Denmark
Coordinates	Lat. (^o)	56.496244	Long. (^o)	9.599689	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082560	Metagenome	113	N

Sequences

Protein ID	Family	RBS	Sequence
Foulum_10005012	F082560	GGAGG	VSEKLIVKKIQEWFKAKGGVCHKVHGGPMSAGFPDIIGCMRGRTWVVEVKVPGAKPRVPRAKRNEAPQEIQEWLTMGATMLQAKTLYDWQNAGAVALVATSVEDMEQKFKEGQI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.