Scaffold Soeholt_1004414

Overview

Basic Information

• Taxon OID: 3300000506
• Scaffold ID: Soeholt_1004414
• Source Dataset Name: Anaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludge
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Aalborg University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 17401
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 13 (76.47%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark

Source Dataset Sampling Location

• Location Name: Soeholt, Denmark
• Coordinates
  • Lat. (^o): 57.363486
  • Long. (^o): 10.268131

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019675	Metagenome	228	Y

Sequences

Protein ID	Family	RBS	Sequence
Soeholt_10044147	F019675	N/A	MHRTRQIITAVMGALGVLLIARGVWGGVWPVSVQLVAGVALAVYAVLRWRYTL*