NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Soeholt_1003952

Scaffold Soeholt_1003952


Overview

Basic Information
Taxon OID3300000506 Open in IMG/M
Scaffold IDSoeholt_1003952 Open in IMG/M
Source Dataset NameAnaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludge
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAalborg University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)18504
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (88.24%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark

Source Dataset Sampling Location
Location NameSoeholt, Denmark
CoordinatesLat. (o)57.363486Long. (o)10.268131Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038290Metagenome / Metatranscriptome166Y
F042959Metagenome / Metatranscriptome157N
F055836Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Soeholt_100395212F055836GGAGVVTIYKKKWSRQFLGFIAVTMRWPMLLLLSLGRFLKINCIFTVYPGSQRDVDGYFPKGLKWFLKPVASGKPFVAGVITTGNGLGRGLVLAVPNTVDQFRQDRELVGTIMKNLKLTRTLTGARTIAIAGQGPRFFRSHFPYEQPFVYGLKGRVFSVVETVERVTEKHGLRKEQTTVAILGVGEIGAAIISNLEEKGYRAVGIEIRIADGRVEIGREGMERLKGADLVVVQTPRGDDVVPYYGNLKDTAILIDDSHPRITVRPDDVKFYKVAIGRSGVEFRPPLPGYEKYWIPGCVQESMVVAESGKVDLSQEDFNRRSKELGFFAHLVDDR*
Soeholt_100395215F042959N/AMARRKQPAGRIDLKGLDASEIRVRLKEVGPVAEIRLTRANLPLFEEDEFELSLAWGGQRKTYKIPVREGKPLFGALPDSVTGLVERKPQKGAGNLIRELTLAGAAGEATFPMSWGYAIPEEWKPLERIYNGVIEMARRLSGWQVF*
Soeholt_10039529F038290AGGAGMNTTVIDRARGVGKVRKLRVRSASRRGSLVRRFRNFIELSDWDEDLLRRSREIDAFCWMLAVGAAALMVPVSFLVMKG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.