Basic Information | |
---|---|
Taxon OID | 3300000506 Open in IMG/M |
Scaffold ID | Soeholt_1000847 Open in IMG/M |
Source Dataset Name | Anaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludge |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Aalborg University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 24000 |
Total Scaffold Genes | 24 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 21 (87.50%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester → Anaerobic Digester Microbial Communities From Soeholt, Denmark |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Soeholt, Denmark | |||||||
Coordinates | Lat. (o) | 57.363486 | Long. (o) | 10.268131 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045834 | Metagenome / Metatranscriptome | 152 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Soeholt_10008478 | F045834 | GAGG | MKRQHETRMLLFLMTGTAILFFAAAVPLSGFGFFLLAQVAGLVLGGITLVSLFRRYRGLDLFSAASIYVLYVLMIALFSPGVVNALARYLTK* |
⦗Top⦘ |