Scaffold BPH_13047

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BPH_13047

Scaffold BPH_13047

Overview

Basic Information
Taxon OID	3300000478 Open in IMG/M
Scaffold ID	BPH_13047 Open in IMG/M
Source Dataset Name	Deep mine microbial communities from Beatrix mine, South Africa, that are thermophilic, sample 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Inqaba Biotechnologies
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1767
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Mine → Deep Mine → Deep Mine Microbial Communities From Beatrix Mine, South Africa, That Are Thermophilic

Source Dataset Sampling Location
Location Name	Beatrix mine, Free State, South Africa
Coordinates	Lat. (^o)	-28.3	Long. (^o)	26.75	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015419	Metagenome / Metatranscriptome	255	Y

Sequences

Protein ID	Family	RBS	Sequence
BPH_130473	F015419	N/A	MEYKVQITDEAGNIRQYNVSRSSSSEDKSLNDFILEALQISEDKRKLPLKIQCPNGLEVYPSIKMKFENYGSPLLGDKLEAMHITWRDGL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.