Scaffold TBL_comb48_EPIDRAFT_1000850

Overview

Basic Information

• Taxon OID: 3300000439
• Scaffold ID: TBL_comb48_EPIDRAFT_1000850
• Source Dataset Name: Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 23493
• Total Scaffold Genes: 35
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (17.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Trout Bog, Vilas County, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.0412
  • Long. (^o): -89.6864

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068582	Metagenome / Metatranscriptome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
TBL_comb48_EPIDRAFT_100085010	F068582	N/A	MTTLYGIRTITEQSLLALFQANATMLPSVELVAGQTDAIRSLPIIIIHAESAQAHPDLGGTPNGNFAITVRIYVYSSADDSTLAQHRARVEATQAIMEDFATMQSLWQQGTLYFSQVISDDEGVADRRWGNVIQYSLVAVYPPQ*