Scaffold P_2C_Liq_1_UnCtyDRAFT_1008525

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold P_2C_Liq_1_UnCtyDRAFT_1008525

Scaffold P_2C_Liq_1_UnCtyDRAFT_1008525

Overview

Basic Information
Taxon OID	3300000418 Open in IMG/M
Scaffold ID	P_2C_Liq_1_UnCtyDRAFT_1008525 Open in IMG/M
Source Dataset Name	Marine microbial community from Union City, CA, USA - Pond 2C Liquid 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	2684
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (38.46%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location Name	Eden Landing Ponds, San Francisco, CA, USA
Coordinates	Lat. (^o)	37.569167	Long. (^o)	-122.1019	Alt. (m)		Depth (m)	.13
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082265	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
P_2C_Liq_1_UnCtyDRAFT_10085251	F082265	GAG	MFSVEFDWDEVCITVIDDTGNHGDLKVHAFDDIVYITQDDPELDTTHLLEINPAMWEELLTAIHSPEGFFMRKRK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.