Scaffold LV_Brine_h2_0102DRAFT_1051885

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LV_Brine_h2_0102DRAFT_1051885

Scaffold LV_Brine_h2_0102DRAFT_1051885

Overview

Basic Information
Taxon OID	3300000405 Open in IMG/M
Scaffold ID	LV_Brine_h2_0102DRAFT_1051885 Open in IMG/M
Source Dataset Name	Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	693
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica

Source Dataset Sampling Location
Location Name	Lake Vida, Antarctica
Coordinates	Lat. (^o)	-77.38861	Long. (^o)	161.931111	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099976	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
LV_Brine_h2_0102DRAFT_10518851	F099976	GGAGG	MSKSQAKRRNEGGQAKRQEIIELFKSMGHTQLNDGREISDLHLNELQELLKYGIKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.